PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02870A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 306aa    MW: 32706.1 Da    PI: 4.904
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02870AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-151158148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W+++Ede+l d + ++G g+W++ +++ g++R +k+c++rw +yl
  Oropetium_20150105_02870A 11 KGLWSPDEDEKLRDFILRYGHGCWSALPAKAGLNRNGKSCRLRWINYL 58
                               678*******************************************97 PP

2Myb_DNA-binding53.46.1e-1765109248
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                g +T+eE++    +++ lG++ W++Iar+++ gRt++++k++w++yl
  Oropetium_20150105_02870A  65 GMFTPEEEDTVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 109
                                569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.066658IPR017930Myb domain
SuperFamilySSF466894.4E-298105IPR009057Homeodomain-like
SMARTSM007176.3E-121060IPR001005SANT/Myb domain
PfamPF002493.7E-131158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-201264IPR009057Homeodomain-like
CDDcd001673.29E-101458No hitNo description
PROSITE profilePS5129425.09459113IPR017930Myb domain
SMARTSM007177.5E-1463111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565112IPR009057Homeodomain-like
PfamPF002491.6E-1565109IPR001005SANT/Myb domain
CDDcd001679.04E-1267109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
ACEKPKPNYR KGLWSPDEDE KLRDFILRYG HGCWSALPAK AGLNRNGKSC RLRWINYLRP  60
GLKHGMFTPE EEDTVMSLHA ALGNKWSRIA RHLPGRTDNE VKNYWNSYLK KRVEGSSKEA  120
GPSTPAPTAT NSSADSDDSH CAMSGDDDGT AAVPEPPTDS GLSEPRESSS ADSSCLTGPH  180
PACRPHAPLA APKVMFADWL DMDYISGQVA AVAAPGLDAV IGASASANPG DQRQGSVQQQ  240
QQQQVDGPCS GFDVSSMSTS LHGGFGDSGA GCWEFQEQFD GMDQMQTAGA FCDLLSMSDF  300
FAGLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2671143109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794121e-137HF679412.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB6 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953256.11e-145PREDICTED: myb-related protein Myb4
TrEMBLK3YUK11e-145K3YUK1_SETIT; Uncharacterized protein
STRINGSi017947m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.14e-56myb domain protein 18